PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G03110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 330aa    MW: 36257.6 Da    PI: 8.2962
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G03110.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.8e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l++ ++++G+g +W + +++ g++R++k+c++rw++yl
  LPERR04G03110.1 14 KGPWSPEEDAKLKEFIEKHGTGgNWIALPQKAGLRRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding39.41.4e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+ Ed  + + ++  G++ W+ Ia++++ gRt++++k++w++
  LPERR04G03110.1  69 GEFTEHEDRVICNMFANIGSR-WSIIASHLP-GRTDNDIKNYWNT 111
                      78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.884966IPR017930Myb domain
SuperFamilySSF466891.08E-2711109IPR009057Homeodomain-like
SMARTSM007179.4E-131364IPR001005SANT/Myb domain
PfamPF002499.8E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-241569IPR009057Homeodomain-like
CDDcd001671.26E-91662No hitNo description
SMARTSM007179.7E-1267115IPR001005SANT/Myb domain
PROSITE profilePS5129416.10767117IPR017930Myb domain
PfamPF002491.8E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009785Biological Processblue light signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGRAPCCDKN NVKKGPWSPE EDAKLKEFIE KHGTGGNWIA LPQKAGLRRC GKSCRLRWLN  60
YLRPNIKHGE FTEHEDRVIC NMFANIGSRW SIIASHLPGR TDNDIKNYWN TKLKKKLLGP  120
AAGAGAAPPR SLQRQLHNHR SLLLPNSPLP NHSGSYGGGF FSGVGSFQHQ EQTMPTLTLP  180
TNTTHDYMLG SQQSGLQMAS ASALLNHLQG VAHHHQLQVK EENSSNMIVF GSDQQSCSSS  240
DGRELIFDGS AYSYGGGYNS SCIDQVVDNK LFQYQQDHQA VQDQQIVYNY DEIKQLLMNT  300
TTNAAGQDHG GGGGSMEGLI GSSQGKVTMM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0962051e-111FP096205.1 Phyllostachys edulis cDNA clone: bphylf043l07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975125.11e-114PREDICTED: transcription factor RAX2-like
TrEMBLA0A0D9W2R60.0A0A0D9W2R6_9ORYZ; Uncharacterized protein
STRINGBGIOSGA011155-PA1e-145(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.14e-70myb domain protein 68